Recombinant Human FGF2 Protein

Recombinant Human FGF2 Protein
SKU
ASBPP-3005-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P09038

Gene Name: FGF2

Expression System: Escherichia coli

Molecular Weight: 59 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Pro143

End Site: Ser288

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 99%

Alternative gene names: FGFB

Alternative protein names: Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

Protein name: fibroblast growth factor 2

Full length: 288 amino acids

Entry name: FGF2_HUMAN

Product panel: Cytokines,Neuroscience Biomarkers
More Information
SKU ASBPP-3005-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3005-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 2247
Product information (PDF)
×
MSDS (PDF)
×