Recombinant Human FKBPL Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UIM3

Gene Name: FKBPL

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 57%

Start Site: Glu11

End Site: Leu120

Coverage: 0.33

Isoelectric Point: 5.5

Core Sequence: EKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 57%, Rat - 62%, Pig - 71%, Cynomolgus monkey - 91%

Alternative gene names: DIR1; NG7

Alternative protein names: FK506-binding protein-like; WAF-1/CIP1 stabilizing protein 39; WISp39

Protein name: FKBP prolyl isomerase like

Full length: 349 amino acids

Entry name: FKBPL_HUMAN

• SKU: ASBPP-421-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-421-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 63943