Recombinant Human FOXP4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IVH2

Gene Name: FOXP4

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Arg11

End Site: Gln100

Coverage: 0.15

Isoelectric Point: 5.5

Core Sequence: RSAPSGQNGVGSLSGQADGSSGGATGTTASGTGREVTTGADSNGEMSPAELLHFQQQQALQVARQFLLQQASGLSSPGNNDSKQSASAVQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Pig - 89%, Cynomolgus monkey - 97%

Alternative gene names: FKHLA

Alternative protein names: Forkhead box protein P4; Fork head-related protein-like A

Protein name: forkhead box P4

Full length: 680 amino acids

Entry name: FOXP4_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3104-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3104-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 116113