Recombinant Human FRG2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q64ET8

Gene Name: FRG2

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Tyr91

End Site: Leu190

Coverage: 0.38

Isoelectric Point: 9.5

Core Sequence: YRENCRKRKMSSKDSCQDTAGNCPEKECSLSLNKKSRSSTAVHNSEIQETCDAHHRGHSRACTGHSKRHRSRALGVQTPSIRKSLVTSVRAMSEAVYQDL

Homologies: Highest protein sequence identity to the following orthologs: Pig - 46%, Cynomolgus monkey - 89%

Alternative gene names: FRG2A

Alternative protein names: Protein FRG2; FSHD region gene 2 protein

Protein name: FSHD region gene 2

Full length: 278 amino acids

Entry name: FRG2_HUMAN

• SKU: ASBPP-10454-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10454-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 448831