Recombinant Human FRZB Protein

Recombinant Human FRZB Protein
SKU
ASBPP-3013-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q92765

Gene Name: FRZB

Expression System: Escherichia coli

Molecular Weight: 31.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Phe161

End Site: Pro320

Coverage: 0.56

Isoelectric Point: 9

Core Sequence: FPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 39%, Pig - 95%

Alternative gene names: FIZ; FRE; FRP; FRZB1; SFRP3

Alternative protein names: Secreted frizzled-related protein 3; sFRP-3; Frezzled; Fritz; Frizzled-related protein 1; FrzB-1

Protein name: frizzled related protein

Full length: 325 amino acids

Entry name: SFRP3_HUMAN
More Information
SKU ASBPP-3013-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3013-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 2487
Product information (PDF)
×
MSDS (PDF)
×