Recombinant Human GARS Protein

Recombinant Human GARS Protein
SKU
ASBPP-288-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P41250

Gene Name: GARS1

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Glu61

End Site: Arg130

Coverage: 0.11

Isoelectric Point: 8

Core Sequence: EEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 96%, Cynomolgus monkey - 100%

Alternative gene names: GARS

Alternative protein names: Glycine--tRNA ligase; Diadenosine tetraphosphate synthetase; Ap4A synthetase; Glycyl-tRNA synthetase; GlyRS; Glycyl-tRNA synthetase 1

Protein name: glycyl-tRNA synthetase 1

Full length: 739 amino acids

Entry name: GARS_HUMAN

Product panel: Autoimmune Disease,Enzyme
More Information
SKU ASBPP-288-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-288-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 2617
Product information (PDF)
×
MSDS (PDF)
×