Recombinant Human GCA Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P28676

Gene Name: GCA

Expression System: Escherichia coli

Molecular Weight: 58.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Gly11

End Site: Leu150

Coverage: 0.68

Isoelectric Point: 5

Core Sequence: GNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAVAGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVEHHELRQAIGL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 33%, Pig - 74%, Cynomolgus monkey - 90%

Alternative gene names: GCL

Alternative protein names: Grancalcin

Protein name: grancalcin

Full length: 217 amino acids

Entry name: GRAN_HUMAN

• SKU: ASBPP-4120-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4120-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 25801