Recombinant Human GDF15 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q99988

Gene Name: GDF15

Expression System: Escherichia coli

Molecular Weight: 24.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Asp201

End Site: Leu300

Coverage: 0.98

Isoelectric Point: 6.5

Core Sequence: DHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 69%, Pig - 67%

Alternative gene names: MIC1; PDF; PLAB; PTGFB

Alternative protein names: Growth/differentiation factor 15; GDF-15; Macrophage inhibitory cytokine 1; MIC-1; NSAID-activated gene 1 protein; NAG-1; NSAID-regulated gene 1 protein; NRG-1; Placental TGF-beta; Placental bone morphogenetic protein; Prostate differentiation factor

Protein name: growth differentiation factor 15

Full length: 308 amino acids

Entry name: GDF15_HUMAN

Product panel: Cytokines

• SKU: ASBPP-3777-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3777-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 9518