Recombinant Human GDF5 Protein

Recombinant Human GDF5 Protein
SKU
ASBPP-3778-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P43026

Gene Name: GDF5

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Ala382

End Site: Arg501

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 81%, Pig - 99%

Alternative gene names: BMP14; CDMP1

Alternative protein names: Growth/differentiation factor 5; GDF-5; Bone morphogenetic protein 14; BMP-14; Cartilage-derived morphogenetic protein 1; CDMP-1; Lipopolysaccharide-associated protein 4; LAP-4; LPS-associated protein 4; Radotermin

Protein name: growth differentiation factor 5

Full length: 501 amino acids

Entry name: GDF5_HUMAN

Product panel: Cytokines
More Information
SKU ASBPP-3778-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3778-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 8200
Product information (PDF)
×
MSDS (PDF)
×