Note: Dry Ice fees will be extra-charged
Uniprot: Q9UJY5
Gene Name: GGA1
Expression System: Escherichia coli
Molecular Weight: 16.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 98%
Start Site: Leu181
End Site: Gly300
Coverage: 0.20
Isoelectric Point: 6
Core Sequence: LLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRG
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 58%, Pig - 97%, Cynomolgus monkey - 99%
Alternative gene names: /
Alternative protein names: ADP-ribosylation factor-binding protein GGA1; Gamma-adaptin-related protein 1; Golgi-localized; gamma ear-containing; ARF-binding protein 1
Protein name: golgi associated, gamma adaptin ear containing, ARF binding protein 1
Full length: 639 amino acids
Entry name: GGA1_HUMAN
English
Deutsch
