Recombinant Human GGACT Protein

Recombinant Human GGACT Protein
SKU
ASBPP-4223-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BVM4

Gene Name: GGACT

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Met1

End Site: Arg153

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 68%, Pig - 73%, Cynomolgus monkey - 92%

Alternative gene names: A2LD1

Alternative protein names: Gamma-glutamylaminecyclotransferase; GGACT; AIG2-like domain-containing protein 1; Gamma-glutamylamine cyclotransferase

Protein name: gamma-glutamylamine cyclotransferase

Full length: 153 amino acids

Entry name: GGACT_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4223-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4223-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 87769
Product information (PDF)
×
MSDS (PDF)
×