Recombinant Human GGACT Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BVM4

Gene Name: GGACT

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Met1

End Site: Arg153

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 68%, Pig - 73%, Cynomolgus monkey - 92%

Alternative gene names: A2LD1

Alternative protein names: Gamma-glutamylaminecyclotransferase; GGACT; AIG2-like domain-containing protein 1; Gamma-glutamylamine cyclotransferase

Protein name: gamma-glutamylamine cyclotransferase

Full length: 153 amino acids

Entry name: GGACT_HUMAN

Product panel: Enzyme

• SKU: ASBPP-4223-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4223-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 87769