Recombinant Human GJD4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96KN9

Gene Name: GJD4

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 36%

Start Site: Arg221

End Site: Val370

Coverage: 0.41

Isoelectric Point: 10.5

Core Sequence: RRRMRRRPGPPTSPSIRKQSGASGHAEGRRTDEEGGREEEGAPAPPGARAGGEGAGSPRRTSRVSGHTKIPDEDESEVTSSASEKLGRQPRGRPHREAAQDPRGSGSEEQPSAAPSRLAAPPSCSSLQPPDPPASSSGAPHLRARKSEWV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 36%, Cynomolgus monkey - 91%

Alternative gene names: CX40.1

Alternative protein names: Gap junction delta-4 protein; Connexin-40.1; Cx40.1

Protein name: gap junction protein delta 4

Full length: 370 amino acids

Entry name: CXD4_HUMAN

• SKU: ASBPP-3192-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3192-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 219770