Recombinant Human GKN1 Protein

Recombinant Human GKN1 Protein
SKU
ASBPP-403-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NS71

Gene Name: GKN1

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Ser41

End Site: Val170

Coverage: 0.81

Isoelectric Point: 7.5

Core Sequence: SVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Rat - 28%, Pig - 79%, Cynomolgus monkey - 93%

Alternative gene names: AMP18; CA11

Alternative protein names: Gastrokine-1; 18 kDa antrum mucosa protein; AMP-18; Protein CA11

Protein name: gastrokine 1

Full length: 185 amino acids

Entry name: GKN1_HUMAN

Product panel: Cytokines
More Information
SKU ASBPP-403-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-403-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 56287
Product information (PDF)
×
MSDS (PDF)
×