Recombinant Human GLIS1 Protein

Recombinant Human GLIS1 Protein
SKU
ASBPP-3780-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8NBF1

Gene Name: GLIS1

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Pro261

End Site: Glu370

Coverage: 0.18

Isoelectric Point: 9.5

Core Sequence: PNKCMFEGCSKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCSKRYTDPSSLRKHVKAHSAKEQQVRKKLHAGPDTEADVLTE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 48%, Pig - 97%

Alternative gene names: /

Alternative protein names: Zinc finger protein GLIS1; GLI-similar 1

Protein name: GLIS family zinc finger 1

Full length: 620 amino acids

Entry name: GLIS1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3780-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3780-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 148979
Product information (PDF)
×
MSDS (PDF)
×