Recombinant Human GLP2R Protein

Recombinant Human GLP2R Protein
SKU
ASBPP-4343-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O95838

Gene Name: GLP2R

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 67%

Start Site: Phe471

End Site: Glu550

Coverage: 0.15

Isoelectric Point: 6.5

Core Sequence: FRFLGKCPKKLSEGDGAEKLRKLQPSLNSGRLLHLAMRGLGELGAQPQQDHARWPRGSSLSECSEGDVTMANTMEEILEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 67%, Rat - 67%, Pig - 64%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Glucagon-like peptide 2 receptor; GLP-2 receptor; GLP-2-R; GLP-2R

Protein name: glucagon like peptide 2 receptor

Full length: 553 amino acids

Entry name: GLP2R_HUMAN
More Information
SKU ASBPP-4343-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4343-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 9340
Product information (PDF)
×
MSDS (PDF)
×