Recombinant Human GMPR2 Protein

Recombinant Human GMPR2 Protein
SKU
ASBPP-4039-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9P2T1

Gene Name: GMPR2

Expression System: Escherichia coli

Molecular Weight: 39 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Met1

End Site: Cys348

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 80%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: GMP reductase 2; GMPR 2; Guanosine 5'-monophosphate oxidoreductase 2; Guanosine monophosphate reductase 2

Protein name: guanosine monophosphate reductase 2

Full length: 348 amino acids

Entry name: GMPR2_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4039-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4039-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 51292
Product information (PDF)
×
MSDS (PDF)
×