Recombinant Human GON7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BXV9

Gene Name: GON7

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Glu11

End Site: Ser100

Coverage: 0.96

Isoelectric Point: 4.5

Core Sequence: EGKPQKLRVSCEAPGDGDPFQGLLSGVAQMKDMVTELFDPLVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Pig - 77%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: EKC/KEOPS complex subunit GON7

Protein name: GON7 subunit of KEOPS complex

Full length: 100 amino acids

Entry name: GON7_HUMAN

• SKU: ASBPP-3172-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3172-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 84520