Note: Dry Ice fees will be extra-charged
Uniprot: Q13224
Gene Name: GRIN2B
Expression System: Escherichia coli
Molecular Weight: 17.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 95%
Start Site: Leu1251
End Site: Asp1380
Coverage: 0.10
Isoelectric Point: 9
Core Sequence: LYDISEDNSLQELDQPAAPVAVTSNASTTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPRSVSLKDKGRFMDGSPYAHMFEMSAGESTFANNKSSVPTAGHHHHNNPGGGYMLSKSLYPD
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 96%, Pig - 93%, Cynomolgus monkey - 100%
Alternative gene names: NMDAR2B
Alternative protein names: Glutamate receptor ionotropic; NMDA 2B; GluN2B; Glutamate [NMDA] receptor subunit epsilon-2; N-methyl D-aspartate receptor subtype 2B; NMDAR2B; NR2B; N-methyl-D-aspartate receptor subunit 3; NR3; hNR3
Protein name: glutamate ionotropic receptor NMDA type subunit 2B
Full length: 1484 amino acids
Entry name: NMDE2_HUMAN
Product panel: Neurodegenerative Diseases Marker,Autoimmune Disease,Neuroscience Biomarkers
English
Deutsch
