Recombinant Human GRIN3B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O60391

Gene Name: GRIN3B

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 74%

Start Site: Arg881

End Site: Ala950

Coverage: 0.08

Isoelectric Point: 6

Core Sequence: RALNTEPPEGSKEETAEAEPSGPEVEQQQQQQDQPTAPEGWKRARRAVDKERRVRFLLEPAVVVAPEADA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 74%, Rat - 75%, Pig - 52%

Alternative gene names: /

Alternative protein names: Glutamate receptor ionotropic; NMDA 3B; GluN3B; N-methyl-D-aspartate receptor subtype 3B; NMDAR3B; NR3B

Protein name: glutamate ionotropic receptor NMDA type subunit 3B

Full length: 1043 amino acids

Entry name: NMD3B_HUMAN

Product panel: Autoimmune Disease

• SKU: ASBPP-4327-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4327-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 116444