Recombinant Human GSTM4 Protein

Recombinant Human GSTM4 Protein
SKU
ASBPP-3882-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q03013

Gene Name: GSTM4

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Met1

End Site: Lys218

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 89%, Pig - 83%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Glutathione S-transferase Mu 4; GST class-mu 4; GST-Mu2; GSTM4-4; Leukotriene C4 synthase GSTM4

Protein name: glutathione S-transferase mu 4

Full length: 218 amino acids

Entry name: GSTM4_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3882-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3882-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 2948
Product information (PDF)
×
MSDS (PDF)
×