Recombinant Human GTF2IRD2 Protein

Recombinant Human GTF2IRD2 Protein
SKU
ASBPP-10483-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q86UP8

Gene Name: GTF2IRD2

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Arg181

End Site: Lys320

Coverage: 0.16

Isoelectric Point: 4

Core Sequence: RPFLGPESQLGGPGMVTDAERSIVSPSESCGPINVKTEPMEDSGISLKAEAVSVKKESEDPNYYQYNMQGSHPSSTSNEVIEMELPMEDSTPLVPSEEPNEDPEAEVKIEGNTNSSSVTNSAAGVEDLNIVQVTVPDNEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 64%, Pig - 83%, Cynomolgus monkey - 97%

Alternative gene names: GTF2IRD2A

Alternative protein names: General transcription factor II-I repeat domain-containing protein 2A; GTF2I repeat domain-containing protein 2A; Transcription factor GTF2IRD2-alpha

Protein name: GTF2I repeat domain containing 2

Full length: 949 amino acids

Entry name: GTD2A_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10483-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10483-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 84163
Product information (PDF)
×
MSDS (PDF)
×