Recombinant Human GUCY1A2 Protein

Recombinant Human GUCY1A2 Protein
SKU
ASBPP-4418-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P33402

Gene Name: GUCY1A2

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Asp401

End Site: Thr490

Coverage: 0.13

Isoelectric Point: 7

Core Sequence: DKVMEVKGQMIHVPESNSILFLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTHQALEEEKKKT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 93%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: GUC1A2; GUCSA2

Alternative protein names: Guanylate cyclase soluble subunit alpha-2; GCS-alpha-2

Protein name: guanylate cyclase 1 soluble subunit alpha 2

Full length: 732 amino acids

Entry name: GCYA2_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4418-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4418-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 2977
Product information (PDF)
×
MSDS (PDF)
×