Recombinant Human GUCY1B2 Protein

Recombinant Human GUCY1B2 Protein
SKU
ASBPP-4331-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O75343

Gene Name: GUCY1B2

Expression System: Escherichia coli

Molecular Weight: 24 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 50%

Start Site: Lys381

End Site: Thr580

Coverage: 0.33

Isoelectric Point: 9

Core Sequence: KVAAGEFKSCTILFSDVVTFTNICTACEPIQIVNVLNSMYSKFDRLTSVHAVYKVETIGDAYMVVGGVPVPIGNHAQRVANFALGMRISAKEVTNPVTGEPIQLRVGIHTGPVLADVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAYRALKNQGFKIIERGEIEVKGKGRMTTYFLIQNLNATEDEIMGRSKT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 50%, Rat - 89%, Pig - 89%, Cynomolgus monkey - 51%

Alternative gene names: /

Alternative protein names: Guanylate cyclase soluble subunit beta-2; GCS-beta-2

Protein name: guanylate cyclase 1 soluble subunit beta 2 (pseudogene)

Full length: 617 amino acids

Entry name: GCYB2_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4331-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4331-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 2974
Product information (PDF)
×
MSDS (PDF)
×