Recombinant Human HBD Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P02042

Gene Name: HBD

Expression System: Escherichia coli

Molecular Weight: 57.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Ala11

End Site: Asn140

Coverage: 0.93

Isoelectric Point: 6

Core Sequence: AVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVAN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 79%, Pig - 82%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Hemoglobin subunit delta; Delta-globin; Hemoglobin delta chain

Protein name: hemoglobin subunit delta

Full length: 147 amino acids

Entry name: HBD_HUMAN

• SKU: ASBPP-3925-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3925-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 3045