Recombinant Human HCK Protein

Recombinant Human HCK Protein
SKU
ASBPP-4289-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P08631

Gene Name: HCK

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Glu41

End Site: Glu140

Coverage: 0.21

Isoelectric Point: 4.5

Core Sequence: ETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 79%, Pig - 80%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Tyrosine-protein kinase HCK; Hematopoietic cell kinase; Hemopoietic cell kinase; p59-HCK/p60-HCK; p59Hck; p61Hck

Protein name: HCK proto-oncogene, Src family tyrosine kinase

Full length: 526 amino acids

Entry name: HCK_HUMAN

Product panel: DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-4289-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4289-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 3055
Product information (PDF)
×
MSDS (PDF)
×