Recombinant Human HDGF Protein

Recombinant Human HDGF Protein
SKU
ASBPP-311-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P51858

Gene Name: HDGF

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Glu71

End Site: Glu150

Coverage: 0.34

Isoelectric Point: 5.5

Core Sequence: EKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLVIDEPAKEKNE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 96%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: HMG1L2

Alternative protein names: Hepatoma-derived growth factor; HDGF; High mobility group protein 1-like 2; HMG-1L2

Protein name: heparin binding growth factor

Full length: 240 amino acids

Entry name: HDGF_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-311-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-311-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 3068
Product information (PDF)
×
MSDS (PDF)
×