Recombinant Human HEBP1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NRV9

Gene Name: HEBP1

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 88%

Start Site: Leu21

End Site: Val130

Coverage: 0.59

Isoelectric Point: 6

Core Sequence: LSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Pig - 85%, Cynomolgus monkey - 99%

Alternative gene names: HBP

Alternative protein names: Heme-binding protein 1; p22HBP

Protein name: heme binding protein 1

Full length: 189 amino acids

Entry name: HEBP1_HUMAN

• SKU: ASBPP-401-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-401-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 50865