Recombinant Human HELZ2 Protein

Recombinant Human HELZ2 Protein
SKU
ASBPP-10374-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BYK8

Gene Name: HELZ2

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: Gly1001

End Site: Arg1190

Coverage: 0.07

Isoelectric Point: 4.5

Core Sequence: GDEALSPASRDITATTAQTEAAAAPAGDAVKEDVVPGACAAGAAAAAGVESTEAEDAEADFWPWDGELNADDAILRELLDESQKVMVTVGEDGLLDTVARPESLQQARLYENLPPAALRKLLHAEPERYRHCSFVPETFERASAIPLDDASSGPIQVRGRLDCGMAFAGDEVLVQLLSGDKAPEGRLRGR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Pig - 48%

Alternative gene names: KIAA1769; PRIC285

Alternative protein names: Helicase with zinc finger domain 2; ATP-dependent helicase PRIC285; Helicase with zinc finger 2; transcriptional coactivator; PPAR-alpha-interacting complex protein 285; PPAR-gamma DNA-binding domain-interacting protein 1; PDIP1; PPAR-gamma DBD-interacting protein 1; Peroxisomal proliferator-activated receptor A-interacting complex 285 kDa protein

Protein name: helicase with zinc finger 2

Full length: 2649 amino acids

Entry name: HELZ2_HUMAN

Product panel: DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-10374-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10374-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 85441
Product information (PDF)
×
MSDS (PDF)
×