Recombinant Human HEMGN Protein

Recombinant Human HEMGN Protein
SKU
ASBPP-4135-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BXL5

Gene Name: HEMGN

Expression System: Escherichia coli

Molecular Weight: 40.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 46%

Start Site: Lys11

End Site: Glu350

Coverage: 0.71

Isoelectric Point: 5.5

Core Sequence: KHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTGKGNRRGRKRQQNTELKVEPQPQIEKEIVEKALAPIEKKTEPPGSITKVFPSVASPQKVVPEEHFSEICQESNIYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVISVIQDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAEPEEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQETPHSE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 46%, Rat - 43%, Pig - 58%, Cynomolgus monkey - 92%

Alternative gene names: EDAG; NDR

Alternative protein names: Hemogen; Erythroid differentiation-associated gene protein; EDAG-1; Hemopoietic gene protein; Negative differentiation regulator protein

Protein name: hemogen

Full length: 484 amino acids

Entry name: HEMGN_HUMAN
More Information
SKU ASBPP-4135-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4135-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 55363
Product information (PDF)
×
MSDS (PDF)
×