Recombinant Human HERPUD1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q15011

Gene Name: HERPUD1

Expression System: Escherichia coli

Molecular Weight: 30.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Thr11

End Site: Ile260

Coverage: 0.67

Isoelectric Point: 6.5

Core Sequence: TLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQFPAENQPANQNAAPQVVVNPGANQNLRMNAQGGPIVEEDDEI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 35%, Pig - 90%, Cynomolgus monkey - 98%

Alternative gene names: HERP; KIAA0025; MIF1

Alternative protein names: Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein; Methyl methanesulfonate; MMF)-inducible fragment protein 1

Protein name: homocysteine inducible ER protein with ubiquitin like domain 1

Full length: 391 amino acids

Entry name: HERP1_HUMAN

• SKU: ASBPP-4102-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4102-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 9709