Recombinant Human HIC2 Protein

Recombinant Human HIC2 Protein
SKU
ASBPP-10464-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q96JB3

Gene Name: HIC2

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Pro391

End Site: Thr530

Coverage: 0.25

Isoelectric Point: 4.5

Core Sequence: PPYPCKEEEENGKDASEDSAQSGSEGGSGHASAHYMYRQEGYETVSYGDNLYVCIPCAKGFPSSEQLNAHVETHTEEELFIKEEGAYETGSGGAEEEAEDLSAPSAAYTAEPRPFKCSVCEKTYKDPATLRQHEKTHWLT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 35%, Pig - 90%, Cynomolgus monkey - 99%

Alternative gene names: HRG22; KIAA1020; ZBTB30

Alternative protein names: Hypermethylated in cancer 2 protein; Hic-2; HIC1-related gene on chromosome 22 protein; Hic-3; Zinc finger and BTB domain-containing protein 30

Protein name: HIC ZBTB transcriptional repressor 2

Full length: 615 amino acids

Entry name: HIC2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10464-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10464-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 23119
Product information (PDF)
×
MSDS (PDF)
×