Note: Dry Ice fees will be extra-charged
Uniprot: P04035
Gene Name: HMGCR
Expression System: Escherichia coli
Molecular Weight: 14.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 76%
Start Site: Lys351
End Site: Lys460
Coverage: 0.13
Isoelectric Point: 6
Core Sequence: KNPITSPVVTQKKVPDNCCRREPMLVRNNQKCDSVEEETGINRERKVEVIKPLVAETDTPNRATFVVGNSSLLDTSSVLVTQEPEIELPREPRPNEECLQILGNAEKGAK
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 74%, Pig - 83%, Cynomolgus monkey - 96%
Alternative gene names: /
Alternative protein names: 3-hydroxy-3-methylglutaryl-coenzyme A reductase; HMG-CoA reductase
Protein name: 3-hydroxy-3-methylglutaryl-CoA reductase
Full length: 888 amino acids
Entry name: HMDH_HUMAN
Product panel: Autoimmune Disease,Enzyme