Recombinant Human HOXA13 Protein

Recombinant Human HOXA13 Protein
SKU
ASBPP-3715-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P31271

Gene Name: HOXA13

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Ser311

End Site: Val380

Coverage: 0.21

Isoelectric Point: 11.5

Core Sequence: SHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKKV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 56%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: HOX1J

Alternative protein names: Homeobox protein Hox-A13; Homeobox protein Hox-1J

Protein name: homeobox A13

Full length: 388 amino acids

Entry name: HXA13_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3715-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3715-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 3209
Product information (PDF)
×
MSDS (PDF)
×