Recombinant Human HOXA5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P20719

Gene Name: HOXA5

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Ser61

End Site: Pro170

Coverage: 0.47

Isoelectric Point: 5

Core Sequence: SGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 90%, Pig - 96%, Cynomolgus monkey - 63%

Alternative gene names: HOX1C

Alternative protein names: Homeobox protein Hox-A5; Homeobox protein Hox-1C

Protein name: homeobox A5

Full length: 270 amino acids

Entry name: HXA5_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3698-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3698-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3202