Recombinant Human HOXA7 Protein

Recombinant Human HOXA7 Protein
SKU
ASBPP-3700-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P31268

Gene Name: HOXA7

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 88%

Start Site: Lys131

End Site: Glu230

Coverage: 0.46

Isoelectric Point: 6

Core Sequence: KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDEEEEDEEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Rat - 84%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: HOX1A

Alternative protein names: Homeobox protein Hox-A7; Homeobox protein Hox 1.1; Homeobox protein Hox-1A

Protein name: homeobox A7

Full length: 230 amino acids

Entry name: HXA7_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3700-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3700-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 3204
Product information (PDF)
×
MSDS (PDF)
×