Recombinant Human HOXB8 Protein

Recombinant Human HOXB8 Protein
SKU
ASBPP-3703-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P17481

Gene Name: HOXB8

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Leu161

End Site: Gly240

Coverage: 0.34

Isoelectric Point: 9.5

Core Sequence: LEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKLERAPEAADEGDAQKG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: HOX2D

Alternative protein names: Homeobox protein Hox-B8; Homeobox protein Hox-2.4; Homeobox protein Hox-2D

Protein name: homeobox B8

Full length: 243 amino acids

Entry name: HXB8_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3703-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3703-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 3218
Product information (PDF)
×
MSDS (PDF)
×