Recombinant Human HOXB9 Protein

Recombinant Human HOXB9 Protein
SKU
ASBPP-3704-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P17482

Gene Name: HOXB9

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Tyr11

End Site: Lys230

Coverage: 0.90

Isoelectric Point: 7.5

Core Sequence: YVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 87%, Pig - 100%, Cynomolgus monkey - 99%

Alternative gene names: HOX2E

Alternative protein names: Homeobox protein Hox-B9; Homeobox protein Hox-2.5; Homeobox protein Hox-2E

Protein name: homeobox B9

Full length: 250 amino acids

Entry name: HXB9_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3704-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3704-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 3219
Product information (PDF)
×
MSDS (PDF)
×