Recombinant Human HOXC12 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P31275

Gene Name: HOXC12

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Ser201

End Site: Ser280

Coverage: 0.29

Isoelectric Point: 11.5

Core Sequence: SASGAPWYPINSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLREQALS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 54%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: HOC3F; HOX3F

Alternative protein names: Homeobox protein Hox-C12; Homeobox protein Hox-3F

Protein name: homeobox C12

Full length: 282 amino acids

Entry name: HXC12_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3706-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3706-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3228