Recombinant Human HOXC6 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P09630

Gene Name: HOXC6

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Gln121

End Site: Ser200

Coverage: 0.37

Isoelectric Point: 11

Core Sequence: QIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKES

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 75%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: HOX3C

Alternative protein names: Homeobox protein Hox-C6; Homeobox protein CP25; Homeobox protein HHO.C8; Homeobox protein Hox-3C

Protein name: homeobox C6

Full length: 235 amino acids

Entry name: HXC6_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3707-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3707-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3223