Recombinant Human HOXC9 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P31274

Gene Name: HOXC9

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Gly131

End Site: Thr200

Coverage: 0.31

Isoelectric Point: 8.5

Core Sequence: GPGEGRSYPDYMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 94%, Pig - 99%, Cynomolgus monkey - 99%

Alternative gene names: HOX3B

Alternative protein names: Homeobox protein Hox-C9; Homeobox protein Hox-3B

Protein name: homeobox C9

Full length: 260 amino acids

Entry name: HXC9_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3710-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3710-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3225