Recombinant Human HPGDS Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O60760

Gene Name: HPGDS

Expression System: Escherichia coli

Molecular Weight: 24.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Met11

End Site: Trp190

Coverage: 0.99

Isoelectric Point: 6.5

Core Sequence: MRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Rat - 81%, Pig - 89%

Alternative gene names: GSTS; PGDS; PTGDS2

Alternative protein names: Hematopoietic prostaglandin D synthase; H-PGDS; GST class-sigma; Glutathione S-transferase; Glutathione-dependent PGD synthase; Glutathione-requiring prostaglandin D synthase; Prostaglandin-H2 D-isomerase

Protein name: hematopoietic prostaglandin D synthase

Full length: 199 amino acids

Entry name: HPGDS_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3733-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3733-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 27306