Recombinant Human HRAS Protein

Recombinant Human HRAS Protein
SKU
ASBPP-4348-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P01112

Gene Name: HRAS

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Cys186

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: HRAS1

Alternative protein names: GTPase HRas; H-Ras-1; Ha-Ras; Transforming protein p21; c-H-ras; p21ras) [Cleaved into: GTPase HRas; N-terminally processed]

Protein name: HRas proto-oncogene, GTPase

Full length: 189 amino acids

Entry name: RASH_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4348-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4348-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 3265
Product information (PDF)
×
MSDS (PDF)
×