Recombinant Human HRH1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P35367

Gene Name: HRH1

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 56%

Start Site: Cys221

End Site: Ala370

Coverage: 0.33

Isoelectric Point: 7.5

Core Sequence: CQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 56%, Rat - 58%, Pig - 74%, Cynomolgus monkey - 90%

Alternative gene names: /

Alternative protein names: Histamine H1 receptor; H1R; HH1R

Protein name: histamine receptor H1

Full length: 487 amino acids

Entry name: HRH1_HUMAN

• SKU: ASBPP-4419-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4419-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3269