Recombinant Human HROB Protein

Recombinant Human HROB Protein
SKU
ASBPP-3134-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8N3J3

Gene Name: HROB

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Gly411

End Site: Asp640

Coverage: 0.35

Isoelectric Point: 5.5

Core Sequence: GRSLEDIMVSAPQTPTHGALAKFQTEIVASSQASVEEDFGRGPWLTMKSTLGLDERDPSCFLCTYSIVMVLRKQAALKQLPRNKVPNMAVMIKSLTRSTMDASVVFKDPTGEMQGTVHRLLLETCQNELKPGSVLLLKQIGVFSPSLRNHYLNVTPNNLVHIYSPDSGDGSFLKPSQPFPKDSGSFQHDVAAKPEEGFRTAQNLEAEASPEEELPEADDLDGLLSELPED

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Rat - 86%, Pig - 83%, Cynomolgus monkey - 95%

Alternative gene names: C17orf53

Alternative protein names: Homologous recombination OB-fold protein

Protein name: homologous recombination factor with OB-fold

Full length: 647 amino acids

Entry name: HROB_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3134-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3134-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 78995
Product information (PDF)
×
MSDS (PDF)
×