Recombinant Human HSF4 Protein

Recombinant Human HSF4 Protein
SKU
ASBPP-3081-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULV5

Gene Name: HSF4

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Ile261

End Site: Pro350

Coverage: 0.21

Isoelectric Point: 5

Core Sequence: IISDIPEDSPSPEGTRLSPSSDGRREKGLALLKEEPASPGGDGEAGLALAPNECDFCVTAPPPLPVAVVQAILEGKGSFSPEGPRNAQQP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Pig - 92%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Heat shock factor protein 4; HSF 4; hHSF4; Heat shock transcription factor 4; HSTF 4

Protein name: heat shock transcription factor 4

Full length: 492 amino acids

Entry name: HSF4_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3081-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3081-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 3299
Product information (PDF)
×
MSDS (PDF)
×