Recombinant Human HTR1A Protein

Recombinant Human HTR1A Protein
SKU
ASBPP-4273-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P08908

Gene Name: HTR1A

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 74%

Start Site: Ala221

End Site: Glu340

Coverage: 0.30

Isoelectric Point: 11

Core Sequence: AARFRIRKTVKKVEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 74%, Rat - 76%, Pig - 77%, Cynomolgus monkey - 96%

Alternative gene names: ADRB2RL1; ADRBRL1

Alternative protein names: 5-hydroxytryptamine receptor 1A; 5-HT-1A; 5-HT1A; G-21; Serotonin receptor 1A

Protein name: 5-hydroxytryptamine receptor 1A

Full length: 422 amino acids

Entry name: 5HT1A_HUMAN

Product panel: Neuroscience Biomarkers
More Information
SKU ASBPP-4273-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4273-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 3350
Product information (PDF)
×
MSDS (PDF)
×