Recombinant Human HTR1F Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P30939

Gene Name: HTR1F

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Leu211

End Site: Arg280

Coverage: 0.22

Isoelectric Point: 10.5

Core Sequence: LYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 87%, Pig - 88%, Cynomolgus monkey - 94%

Alternative gene names: HTR1EL

Alternative protein names: 5-hydroxytryptamine receptor 1F; 5-HT-1F; 5-HT1F; Serotonin receptor 1F

Protein name: 5-hydroxytryptamine receptor 1F

Full length: 366 amino acids

Entry name: 5HT1F_HUMAN

Product panel: Neuroscience Biomarkers

• SKU: ASBPP-4412-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4412-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3355