Recombinant Human HTR2A Protein

Recombinant Human HTR2A Protein
SKU
ASBPP-4404-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P28223

Gene Name: HTR2A

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Phe391

End Site: Cys470

Coverage: 0.18

Isoelectric Point: 9

Core Sequence: FSRYIQCQYKENKKPLQLILVNTIPALAYKSSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 82%, Pig - 87%, Cynomolgus monkey - 99%

Alternative gene names: HTR2

Alternative protein names: 5-hydroxytryptamine receptor 2A; 5-HT-2; 5-HT-2A; Serotonin receptor 2A

Protein name: 5-hydroxytryptamine receptor 2A

Full length: 471 amino acids

Entry name: 5HT2A_HUMAN

Product panel: Neuroscience Biomarkers
More Information
SKU ASBPP-4404-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4404-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 3356
Product information (PDF)
×
MSDS (PDF)
×