Recombinant Human ID4 Protein

Recombinant Human ID4 Protein
SKU
ASBPP-3840-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P47928

Gene Name: ID4

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Met1

End Site: Arg161

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 42%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: BHLHB27

Alternative protein names: DNA-binding protein inhibitor ID-4; Class B basic helix-loop-helix protein 27; bHLHb27; Inhibitor of DNA binding 4; Inhibitor of differentiation 4

Protein name: inhibitor of DNA binding 4

Full length: 161 amino acids

Entry name: ID4_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3840-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3840-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 3400
Product information (PDF)
×
MSDS (PDF)
×